PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001947-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NAC
Protein Properties Length: 362aa    MW: 39921 Da    PI: 8.8547
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001947-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54151421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yLkkkv++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  WALNUT_00001947-RA  15 LPPGFRFHPTDEELVVHYLKKKVSSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 104
                         79****************************.88***************988899************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         vls+ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  WALNUT_00001947-RA 105 VLSSgSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                         ***977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-658176IPR003441NAC domain
PROSITE profilePS5100562.48315176IPR003441NAC domain
PfamPF023652.0E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESTDVSTGS QQPNLPPGFR FHPTDEELVV HYLKKKVSSA PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLSSGS NQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLADNKASNK PPGCDLGNKK NSLRLDDWVL CRIYKKNNTH  180
RPVDHEREDS MDDMIGPIQP SVAVGQHVKL QLLPKGPSTN YGLENYPSMF EGMVSSTDGV  240
NSARAMCQLA CSSSKRELPM VPAMAITSNN FPPKRTLPSL YWNDHDQDAT GPSSSKRLHL  300
DGSDDQSGAR TTDGNASTSI ATLLSQLPQT PSLHQQAMLG SINGDGLFRA PCQQLPGLNW  360
YS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-731417814170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021327.10.0NAC domain protein, IPR003441
SwissprotQ9LD441e-125NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A061F8180.0A0A061F818_THECC; NAC domain protein, IPR003441
STRINGVIT_19s0014g03300.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-126NAC domain containing protein 2